PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009600159.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 1061aa    MW: 118655 Da    PI: 6.7248
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009600159.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.81e-07333426147
                      TSSS-HHHHHHHHHHHHHTTTT...............................................-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg...............................................tWktIartmgkgRtlkqcksrwqky 47 
                      r+ W++eE e l+++vkq   +                                               +W+ +a++   gR++ +c+srw+++
   XP_009600159.1 333 RKEWSKEERENLAKGVKQQFQEmllqrsvdllsnedgrsgesgdldgliasirdvvitpetmrlflpkvNWDQVASMYIPGRSGAECQSRWLNW 426
                      789****************999******************************************************9888************98 PP

2Myb_DNA-binding41.43.4e-13486530146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r  WT+eEd +l  av+ +G  +W ++a+ +  gRt+ qc +rw k
   XP_009600159.1 486 RREWTEEEDIKLCAAVETFGESNWQLVASVIE-GRTGPQCSNRWIK 530
                      678*****************************.***********87 PP

3Myb_DNA-binding37.36.4e-12540597246
                      SSS-HHHHHHHHHHHHHTTTT..............-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGgg..............tWktIartmgkgRtlkqcksrwqk 46 
                      g+W+++Ed++l+ av ++ ++               Wk+I ++++ gRt  qc++rw +
   XP_009600159.1 540 GKWSADEDKRLKVAVMLFHPKswrnigqsvpcrapIWKKITQYVP-GRTHVQCRERWVN 597
                      89*****************99************************.***********87 PP

4Myb_DNA-binding482.8e-15607649347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eEd++l+ a+ ++G   W+++a++++  Rt++qc+ rw  +
   XP_009600159.1 607 KWTEEEDLKLKSAIDEHGYS-WSKVAACVP-PRTDNQCRRRWKVL 649
                      8*****************99.*********.9**********865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.992328427IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.605.3E-10331354IPR009057Homeodomain-like
SMARTSM007172.2E-6332429IPR001005SANT/Myb domain
CDDcd001670.00403390426No hitNo description
Gene3DG3DSA:1.10.10.605.3E-10402436IPR009057Homeodomain-like
SuperFamilySSF466891.72E-12409477IPR009057Homeodomain-like
PROSITE profilePS500906.98428480IPR017877Myb-like domain
SMARTSM007170.022432482IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.5E-8437486IPR009057Homeodomain-like
SuperFamilySSF466893.04E-18466537IPR009057Homeodomain-like
PROSITE profilePS5129418.915481536IPR017930Myb domain
SMARTSM007171.1E-12485534IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-15487536IPR009057Homeodomain-like
CDDcd001672.41E-10488532No hitNo description
PfamPF139211.6E-11489550No hitNo description
PROSITE profilePS500908.595534599IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.606.2E-13537589IPR009057Homeodomain-like
SMARTSM007172.9E-8538601IPR001005SANT/Myb domain
CDDcd001671.21E-5541599No hitNo description
SuperFamilySSF466891.36E-24579651IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-20590647IPR009057Homeodomain-like
PROSITE profilePS5129422.756600654IPR017930Myb domain
SMARTSM007174.1E-14604652IPR001005SANT/Myb domain
CDDcd001673.93E-12607650No hitNo description
PfamPF002492.4E-14607648IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1061 aa     Download sequence    Send to blast
MAFDDDEDFS GSDSDDGFKE DMEALKKACL LAGKETDDLQ PSCSTGDIGG GHVTGSDDVT  60
PSGTDADDVD DDIELVRSIQ ERFALSTELR EPLTLKPLCS LPPPGSEGDD GDDDFETLRA  120
IQRRFAAYDD DSGKGRKESP LDNFEQVGVT NITSEKESSN NFFVERTNAG EGFPACVDGT  180
TQISDGCSNE IASSQNLIEW HDSGAENTAV SVNSFCFPKS AQAFVEAIKK NRSCQKIIRD  240
KMMQIEARIE ELKKLKERVK ILKGFQIASR KRMGRALSQK RDARVQLISL PKQKCSSKLQ  300
GKKLSAMHYG PPENSHVASV REALTHFAVS LSRKEWSKEE RENLAKGVKQ QFQEMLLQRS  360
VDLLSNEDGR SGESGDLDGL IASIRDVVIT PETMRLFLPK VNWDQVASMY IPGRSGAECQ  420
SRWLNWEDPL IKHEEWAILE EKALLHAVQR NEMSNWVDIS ASLGVCRTPF QCLSHYQRSL  480
NASILRREWT EEEDIKLCAA VETFGESNWQ LVASVIEGRT GPQCSNRWIK SLHPTRKRCG  540
KWSADEDKRL KVAVMLFHPK SWRNIGQSVP CRAPIWKKIT QYVPGRTHVQ CRERWVNSLD  600
PSLNLDKWTE EEDLKLKSAI DEHGYSWSKV AACVPPRTDN QCRRRWKVLF PDEVPMLQEA  660
KKIRREAFIS NFVDREEERP ALRPNDIVPT HKLSYRAGCE TASANKKRKL RPRAARDDSA  720
PRCDALCELE RRHLEESEGP ESSDLLNNSS LSSRDQEIER ISDGEEAFEL GYHDSTKNKR  780
PSKLHPRRTK KLAPNDMVPE ASASSKVEST TAVNNICKNR RRTSSLVKKK KTIASQESSS  840
SLPNLSSSMT VVEEVDSHVQ DSGKTMNVMD KCHSTSGYDD SCVNSEGPPL SCPHLDKGTA  900
DLDVGENRVW ENASTIGPQE ASLYFQKNAV VCTDENARQL KASGCHKLNK CNQLKSDGRF  960
SVNNLRETAD DCMTLASFIL KSRAKRRSLS SAKVAKLRPD IAQSTGVAED HSSRSCISGG  1020
HDGVEKTMTQ ECTSSNQISG AEVADDMPLS LVMGRVKRRQ R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C1e-254366466155MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-254366466155MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2389741e-111AC238974.1 Solanum tuberosum clone RHPOTKEY152M21, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009600159.10.0PREDICTED: uncharacterized protein LOC104095683 isoform X1
TrEMBLA0A0V0IVV70.0A0A0V0IVV7_SOLCH; Putative ovule protein (Fragment)
STRINGSolyc03g119050.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA108762124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.11e-169myb domain protein 4r1